Page MenuHomePhabricator

cjming (Clare Ming)
User

Projects

Today

  • Clear sailing ahead.

Tomorrow

  • Clear sailing ahead.

Tuesday

  • Clear sailing ahead.

User Details

User Since
Mar 22 2021, 7:07 PM (97 w, 5 d)
Availability
Available
LDAP User
Clare Ming
MediaWiki User
CMing (WMF) [ Global Accounts ]

Recent Activity

Wed, Feb 1

cjming added a comment to F36578103: testing Metrics Platform 883645.

Screen Shot 2023-02-01 at 3.22.05 PM.png (320×2 px, 137 KB)

Wed, Feb 1, 10:22 PM
cjming claimed T327083: End to end test of the Java MPC in android app.
Wed, Feb 1, 3:54 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming claimed T328458: Inhibit properties on an event if they contain empty values in the Java client.
Wed, Feb 1, 3:54 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T328458: Inhibit properties on an event if they contain empty values in the Java client from Ready to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Wed, Feb 1, 3:54 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming closed T328459: Inhibit properties on an event if they contain empty values in the Swift client as Resolved.
Wed, Feb 1, 3:52 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T324996: Add consistency test for Java MPC from In Review to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Wed, Feb 1, 2:24 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Tue, Jan 31

cjming created T328459: Inhibit properties on an event if they contain empty values in the Swift client.
Tue, Jan 31, 4:42 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming created T328458: Inhibit properties on an event if they contain empty values in the Java client.
Tue, Jan 31, 4:41 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Mon, Jan 30

cjming moved T324996: Add consistency test for Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Mon, Jan 30, 7:33 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Thu, Jan 26

cjming moved T324996: Add consistency test for Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Thu, Jan 26, 12:38 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Tue, Jan 24

cjming moved T324996: Add consistency test for Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Tue, Jan 24, 2:51 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Fri, Jan 20

cjming moved T324996: Add consistency test for Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Fri, Jan 20, 3:49 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318832: Modify the JS Client to be used non MW powered sites from In Review to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Fri, Jan 20, 3:47 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318934: Extend the Java MPC to detect session inactivity from In Review to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Fri, Jan 20, 5:39 AM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming added a comment to F36319349: testing Metrics Platform 878137.

Yay! the integration tests run with console output and local eventgate:

Fri, Jan 20, 5:31 AM
cjming added a comment to F36319349: testing Metrics Platform 878137.

Screen Shot 2023-01-19 at 10.08.41 PM.png (548×1 px, 147 KB)

Fri, Jan 20, 5:09 AM

Thu, Jan 19

cjming added a comment to F36319349: testing Metrics Platform 878137.

Screen Shot 2023-01-19 at 1.24.30 AM.png (1×1 px, 546 KB)

Thu, Jan 19, 8:26 AM

Thu, Jan 12

cjming moved T318934: Extend the Java MPC to detect session inactivity from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Thu, Jan 12, 1:46 AM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T324996: Add consistency test for Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Thu, Jan 12, 1:46 AM · Metrics-Platform-Planning (Metrics Platform Kanban)

Tue, Jan 10

cjming moved T324996: Add consistency test for Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Tue, Jan 10, 4:07 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T320783: Handle the case where there are no stream configs from Ready to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Tue, Jan 10, 4:05 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Jan 5 2023

cjming moved T324996: Add consistency test for Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Jan 5 2023, 7:01 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Dec 14 2022

cjming claimed T325240: Re-enable package cycle check in Java MPC.
Dec 14 2022, 8:28 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming renamed T325240: Re-enable package cycle check in Java MPC from Re-enable package cycle check to Re-enable package cycle check in Java MPC.
Dec 14 2022, 8:27 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming created T325240: Re-enable package cycle check in Java MPC.
Dec 14 2022, 8:27 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming closed T325040: Make events queue capacity configurable in Java MPC as Resolved.

already done in https://gerrit.wikimedia.org/r/c/mediawiki/libs/metrics-platform/+/866659

Dec 14 2022, 2:07 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318935: Refactor Java MPC's event sending code from In Review to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 14 2022, 2:06 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)

Dec 13 2022

cjming claimed T325040: Make events queue capacity configurable in Java MPC.
Dec 13 2022, 4:59 AM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming created T325040: Make events queue capacity configurable in Java MPC.
Dec 13 2022, 4:32 AM · Metrics-Platform-Planning (Metrics Platform Kanban)

Dec 12 2022

cjming moved T324996: Add consistency test for Java MPC from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 9:39 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318934: Extend the Java MPC to detect session inactivity from In Progress to Next Up on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 9:39 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming claimed T324996: Add consistency test for Java MPC.
Dec 12 2022, 9:02 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T324996: Add consistency test for Java MPC from Ready to Next Up on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 9:01 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T320783: Handle the case where there are no stream configs from Next Up to Ready on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 9:01 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming updated the task description for T320783: Handle the case where there are no stream configs.
Dec 12 2022, 8:56 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming added a comment to T320783: Handle the case where there are no stream configs.

To capture the current state of the ToDos in the task description:

Dec 12 2022, 8:53 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318934: Extend the Java MPC to detect session inactivity from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 8:27 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318935: Refactor Java MPC's event sending code from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 8:27 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming created T324996: Add consistency test for Java MPC.
Dec 12 2022, 5:15 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T320783: Handle the case where there are no stream configs from Done to Next Up on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 4:43 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318948: Refactor Java MPC's stream config fetching code from In Review to Done on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 3:45 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T320783: Handle the case where there are no stream configs from In Review to Done on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 12 2022, 3:45 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Dec 9 2022

cjming moved T318934: Extend the Java MPC to detect session inactivity from In Progress to Next Up on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 11:51 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318935: Refactor Java MPC's event sending code from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 11:50 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318934: Extend the Java MPC to detect session inactivity from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 11:46 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318935: Refactor Java MPC's event sending code from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 11:46 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from Sign Off to Done on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 3:53 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from Ready to Deploy to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 3:52 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T320783: Handle the case where there are no stream configs from Next Up to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 9 2022, 3:52 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Dec 8 2022

cjming moved T318948: Refactor Java MPC's stream config fetching code from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 8 2022, 12:08 AM · Metrics-Platform-Planning (Metrics Platform Kanban)

Dec 2 2022

cjming moved T322758: '.custom_data['mode'].data_type' should be equal to one of the allowed values from In Review to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 2 2022, 9:16 AM · Metrics-Platform-Planning (Metrics Platform Kanban), Wikimedia-production-error
cjming moved T309013: EditAttemptStep Migration to MP from In Review to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Dec 2 2022, 9:16 AM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.25; 2022-08-15), Editing-team, DiscussionTools

Nov 29 2022

cjming moved T318935: Refactor Java MPC's event sending code from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 29 2022, 1:57 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Review to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 29 2022, 1:57 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 23 2022

cjming updated the task description for T323735: Prompted for sudo password during deployment.
Nov 23 2022, 9:38 PM · User-brennen, Scap, Release-Engineering-Team
cjming created T323735: Prompted for sudo password during deployment.
Nov 23 2022, 9:37 PM · User-brennen, Scap, Release-Engineering-Team

Nov 22 2022

cjming claimed T318948: Refactor Java MPC's stream config fetching code.
Nov 22 2022, 7:29 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318948: Refactor Java MPC's stream config fetching code from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 22 2022, 7:29 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318934: Extend the Java MPC to detect session inactivity from In Progress to Next Up on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 22 2022, 7:29 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 21 2022

cjming claimed T318934: Extend the Java MPC to detect session inactivity.
Nov 21 2022, 5:36 AM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318934: Extend the Java MPC to detect session inactivity from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 21 2022, 5:35 AM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 21 2022, 5:35 AM · Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 15 2022

cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from Ready to Deploy to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 15 2022, 9:34 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming moved T318935: Refactor Java MPC's event sending code from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 15 2022, 1:03 AM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 14 2022

cjming created T323044: Refactoring Workshop Request.
Nov 14 2022, 4:35 PM · Code-Health-DevEd
cjming moved T318947: Add dispatch method to Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 14 2022, 3:00 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 13 2022

cjming moved T318947: Add dispatch method to Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 13 2022, 9:27 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 10 2022

cjming moved T318947: Add dispatch method to Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 10 2022, 4:44 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 10 2022, 7:09 AM · Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 9 2022

cjming added a comment to T309602: VisualEditorFeatureUse Migration to MP.

Ran this query earlier in Hue (11/7 is when the latest missing config got deployed for testwiki):

SELECT * FROM mediawiki_visual_editor_feature_use WHERE year=2022 AND month=11 AND day>7;

which returned 77 rows -- here's a sampling of the results:

_schemaagentcustom_datadthttpmediawikimetanamepageperformeruser_agent_mapis_wmf_domainnormalized_hostdatacenteryearmonthdayhour
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"editor-switch"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"wikitext-2017"},"integration":{"data_type":"string","value":"discussiontools"}}2022-11-08T20:21:58.568Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/106.0.0.0 Safari/537.36"},"response_headers":null,"status_code":null}{"database":null,"is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-08T20:22:23.093Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.visual-desktop{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":1,"edit_count_bucket":null,"groups":null,"id":47306,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"106","browser_family":"Chrome","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}codfw202211820
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"editor-switch"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"wikitext-2017"},"integration":{"data_type":"string","value":"discussiontools"}}2022-11-08T20:21:53.031Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/106.0.0.0 Safari/537.36"},"response_headers":null,"status_code":null}{"database":null,"is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-08T20:22:23.088Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.visual-desktop{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":1,"edit_count_bucket":null,"groups":null,"id":47306,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"106","browser_family":"Chrome","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}codfw202211820
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"editor-switch"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"visualeditor"},"integration":{"data_type":"string","value":"discussiontools"}}2022-11-08T20:22:00.369Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/106.0.0.0 Safari/537.36"},"response_headers":null,"status_code":null}{"database":null,"is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-08T20:22:23.094Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.source-nwe-desktop{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":1,"edit_count_bucket":null,"groups":null,"id":47306,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"106","browser_family":"Chrome","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}codfw202211820
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"mwSave"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"visualeditor"},"integration":{"data_type":"string","value":"page"}}2022-11-09T10:17:50.575Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:108.0) Gecko/20100101 Firefox/108.0"},"response_headers":null,"status_code":null}{"database":"testwiki","is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-09T10:17:54.016Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.window-open-from-command{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":151,"edit_count_bucket":null,"groups":null,"id":40269,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"108","browser_family":"Firefox","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}eqiad202211910
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"mwSave"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"visualeditor"},"integration":{"data_type":"string","value":"page"}}2022-11-09T10:18:13.478Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:108.0) Gecko/20100101 Firefox/108.0"},"response_headers":null,"status_code":null}{"database":"testwiki","is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-09T10:18:16.109Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.dialog-save{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":152,"edit_count_bucket":null,"groups":null,"id":40269,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"108","browser_family":"Firefox","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}eqiad202211910
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"mwSave"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"visualeditor"},"integration":{"data_type":"string","value":"page"}}2022-11-09T10:17:51.516Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:108.0) Gecko/20100101 Firefox/108.0"},"response_headers":null,"status_code":null}{"database":"testwiki","is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-09T10:17:54.016Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.dialog-save{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":151,"edit_count_bucket":null,"groups":null,"id":40269,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"108","browser_family":"Firefox","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}eqiad202211910
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"mwSave"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"visualeditor"},"integration":{"data_type":"string","value":"page"}}2022-11-09T10:18:12.522Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:108.0) Gecko/20100101 Firefox/108.0"},"response_headers":null,"status_code":null}{"database":"testwiki","is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-09T10:18:16.111Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.window-open-from-command{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":152,"edit_count_bucket":null,"groups":null,"id":40269,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Mac OS X","os_major":"10","os_minor":"15","browser_major":"108","browser_family":"Firefox","device_family":"Mac","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}eqiad202211910
NULL{"app_install_id":null,"client_platform":"mediawiki_js","client_platform_family":"desktop_browser"}{"feature":{"data_type":"string","value":"reference"},"editing_session_id":{"data_type":"string","value":"redacted"},"editor_interface":{"data_type":"string","value":"visualeditor"},"integration":{"data_type":"string","value":"page"}}2022-11-09T11:10:57.606Z{"has_cookies":null,"method":null,"protocol":null,"request_headers":{"user-agent":"Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/107.0.0.0 Safari/537.36"},"response_headers":null,"status_code":null}{"database":"testwiki","is_debug_mode":null,"is_production":null,"site_content_language":null,"site_content_language_variant":null,"skin":null,"version":null}{"domain":"test.wikipedia.org","dt":"2022-11-09T11:11:02.706Z","id":"redacted","request_id":"redacted","stream":"mediawiki.visual_editor_feature_use","uri":null}vefu.context-show{"title":null,"content_language":null,"id":null,"is_redirect":null,"namespace":null,"namespace_name":null,"revision_id":null,"user_groups_allowed_to_edit":null,"user_groups_allowed_to_move":null,"wikidata_id":null}{"can_probably_edit_page":null,"edit_count":null,"edit_count_bucket":null,"groups":null,"id":0,"is_bot":null,"is_logged_in":null,"language":null,"language_variant":null,"name":null,"pageview_id":null,"registration_dt":null,"session_id":null}{"os_family":"Windows","os_major":"10","os_minor":"-","browser_major":"107","browser_family":"Chrome","device_family":"Other","wmf_app_version":"-"}TRUE{"project_class":"wikipedia","project":"test","qualifiers":[],"tld":"org","project_family":"wikipedia"}eqiad202211911

The following properties presumably should be populated? I'll look into these further and file tickets if needed.

Nov 9 2022, 6:56 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 9 2022, 4:29 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Nov 1 2022

cjming moved T309602: VisualEditorFeatureUse Migration to MP from Ready to Deploy to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 1 2022, 9:34 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from Ready to Deploy to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 1 2022, 9:34 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming claimed T318935: Refactor Java MPC's event sending code.
Nov 1 2022, 7:44 PM · Patch-For-Review, Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T309602: VisualEditorFeatureUse Migration to MP from In Review to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 1 2022, 3:40 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming claimed T312016: Increase EditAttemptStep sampling rate(s) to 100%.
Nov 1 2022, 3:40 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from In Progress to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 1 2022, 3:40 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming reassigned T318947: Add dispatch method to Java MPC from cjming to phuedx.
Nov 1 2022, 2:54 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Nov 1 2022, 2:54 PM · Metrics-Platform-Planning (Metrics Platform Kanban)

Oct 31 2022

cjming claimed T318947: Add dispatch method to Java MPC.
Oct 31 2022, 9:06 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Review to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 31 2022, 9:06 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming reassigned T318947: Add dispatch method to Java MPC from cjming to phuedx.
Oct 31 2022, 9:04 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T318947: Add dispatch method to Java MPC from In Progress to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 31 2022, 9:04 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming reassigned T309602: VisualEditorFeatureUse Migration to MP from cjming to phuedx.
Oct 31 2022, 8:42 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T309602: VisualEditorFeatureUse Migration to MP from Sign Off to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 31 2022, 8:42 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming added a comment to T312016: Increase EditAttemptStep sampling rate(s) to 100%.

Will verify data tomorrow since edit_attempt_step sample rate was bumped up to 1 for group0 wikis this afternoon.

Oct 31 2022, 8:36 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from Ready to Deploy to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 31 2022, 8:34 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming claimed T312016: Increase EditAttemptStep sampling rate(s) to 100%.
Oct 31 2022, 6:52 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from In Review to Ready to Deploy on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 31 2022, 6:52 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming reassigned T312016: Increase EditAttemptStep sampling rate(s) to 100% from cjming to phuedx.
Oct 31 2022, 5:22 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from Sign Off to In Review on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 31 2022, 5:21 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming added a comment to T312016: Increase EditAttemptStep sampling rate(s) to 100%.

ok - so turns out the edit_attempt stream sample rate is configured to 1 for testwiki only which explains why we have so few query results. We'll apply that sampling rate for all group0 wikis and expect to see an increase in rows returned starting tomorrow if I can get the config deployed this afternoon.

Oct 31 2022, 5:19 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools
cjming added a comment to T312016: Increase EditAttemptStep sampling rate(s) to 100%.

Ran the following query in Hue since the last DT patch was merged on 10/24:

SELECT * FROM mediawiki_edit_attempt WHERE custom_data IS NOT NULL AND year=2022 AND month=10 AND day > 24 AND day < 31;

Query returned 159 rows. Not sure if this is within reasonable ballpark of expected results. The EAS sampling rate in config $wgWMESchemaEditAttemptStepSamplingRate is set to 0.06 for default and 0.2 for a handful of pilot wikis.

Oct 31 2022, 1:39 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools

Oct 24 2022

cjming updated the task description for T309602: VisualEditorFeatureUse Migration to MP.
Oct 24 2022, 1:24 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T309602: VisualEditorFeatureUse Migration to MP from In Review to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 24 2022, 1:23 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming moved T312016: Increase EditAttemptStep sampling rate(s) to 100% from Ready to Deploy to Sign Off on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 24 2022, 1:23 PM · Patch-For-Review, MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban), MW-1.39-notes (1.39.0-wmf.27; 2022-08-29), Editing-team (Tracking), MobileFrontend, VisualEditor, DiscussionTools

Oct 19 2022

cjming moved T318947: Add dispatch method to Java MPC from Next Up to In Progress on the Metrics-Platform-Planning (Metrics Platform Kanban) board.
Oct 19 2022, 11:21 PM · Metrics-Platform-Planning (Metrics Platform Kanban)
cjming added a comment to T309602: VisualEditorFeatureUse Migration to MP.

Reached out to Editing team in #humansoftheweb channel for their consent before merging associated patches in DiscussionTools + VisualEditor + MobileFrontend.

Oct 19 2022, 11:21 PM · MW-1.40-notes (1.40.0-wmf.7; 2022-10-24), Metrics-Platform-Planning (Metrics Platform Kanban)
cjming added a comment to F35601382: testing VisualEditor 837666.

also verified same event in legacy eventlogging:

Screen Shot 2022-10-19 at 3.35.09 PM.png (690×1 px, 109 KB)

Oct 19 2022, 10:18 PM
cjming added a comment to F35601323: testing DiscussionTools 801733.

also verified legacy eventlogging is still working as well:

Screen Shot 2022-10-19 at 4.04.43 PM.png (708×1 px, 110 KB)

Oct 19 2022, 10:06 PM